Docs
Search docs...⌘K

Overview history - Mentions

API + MCP
GET/v3/brand-radar/mentions-history

Requests to this endpoint consume API units based on the prompts parameter: requests returning only custom prompt data are free, while requests including Ahrefs prompt data follow standard API unit pricing.

Query parameters

wherestring

The filter expression. The following column identifiers are recognized (this differs from the identifiers recognized by the select parameter).

cited_domain: The domain of a page that was used to generate the response.
type: domain

cited_domain_subdomains: The domain of a page that was used to generate the response. Any subdomain of the given domain will also match.
type: string

cited_url_exact: The URL of a page that was used to generate the response.
type: string

cited_url_prefix: The URL of a page that was used to generate the response. Any URL that starts with this prefix will match.
type: string

question: The question asked by the user.
type: string

response (10 units): The response from the model.
type: string

search_queries: The search query used by the chatbot to find information for the response. Note: if data_source does not include chatgpt or perplexity, this field will always be empty.
type: string

topic: The topic of the query.
type: string

date_tostring (date)

The end date of the historical period in YYYY-MM-DD format.

date_fromstring (date)Required

The start date of the historical period in YYYY-MM-DD format.

countrystring

A comma-separated list of two-letter country codes (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw
report_idstring

The ID of the report to use. If one is given, other parameters are taken from the report (market, country, filters). If country or filters are provided, they override the ones in the report. You can find it in the URL of your Brand Radar report in Ahrefs: https://app.ahrefs.com/brand-radar/reports/#report_id#/...

promptsstring

The type of prompts to use. If not specified, both will be used. Custom prompts require a report_id to be provided.

Allowed values:ahrefscustom
data_sourcestringRequired

A comma-separated list of chatbot models. Google keyword models (google_ai_overviews_keywords, google_ai_mode_keywords) cannot be combined with each other or with other models.

Allowed values:chatgptgoogle_ai_overviewsgoogle_ai_modegeminiperplexitycopilotgrokgoogle_ai_overviews_keywordsgoogle_ai_mode_keywords
Example:chatgpt,perplexity
marketstring

A comma-separated list of the niche markets of your brands. Deprecated on 2026-05-18, this parameter will have no effect shortly after this date.

brandstringRequired

The brand to search for.

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

metricsarray<object>
datestring (date)
mentionsinteger

Estimated mentions from responses mentioning the brand.