Top pages

API + MCP

GET/v3/site-explorer/top-pages

Query parameters

timeoutinteger

A manual timeout duration in seconds.

limitinteger

The number of results to return.

Default:1000

order_bystring

A comma-separated list of columns to order results by, with optional direction. See response schema for valid column identifiers.

Example:field_a,field_b:asc,field_c:desc

wherestring

The filter expression. The following column identifiers are recognized (this differs from the identifiers recognized by the select parameter).

selectstringRequired

A comma-separated list of columns to return. See response schema for valid column identifiers.

protocolstring

The protocol of your target.

Allowed values:bothhttphttps

Default:both

targetstring (url)Required

The target of the search: a domain or a URL.

modestring

The scope of the search based on the target you entered.

Allowed values:exactprefixdomainsubdomains

Default:subdomains

countrystring

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw

date_comparedstring (date)

A date to compare metrics with in YYYY-MM-DD format.

datestring (date)Required

A date to report metrics on in YYYY-MM-DD format.

volume_modestring

The search volume calculation mode: monthly or average. It affects volume, traffic, and traffic value.

Allowed values:monthlyaverage

Default:monthly

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

pagesarray<object>

keywordsinteger or null

The total number of keywords that your target ranks for in the top 100 organic search results.

keywords_diffinteger

The change in keywords between your selected dates.

keywords_diff_percentinteger

The change in keywords between your selected dates, in percents.

keywords_mergedinteger

The total number of keywords optimized for sorting.

keywords_previnteger or null

The keyword your target ranks for on the comparison date.

page_typestring or null

Comma-separated list of AI-predicted hierarchical page type paths. Each value is a slash-prefixed path (e.g. /Article/How_to).

raw_urlstring

The ranking page URL in encoded format.

raw_url_prevstring or null

The ranking page URL on the comparison date in encoded format.

referring_domainsinteger or null

(5 units) The number of unique domains linking to a page.

statusstring

The status of a page: the new page that just started to rank ("left"), the lost page that disappeared from search results ("right"), or no change ("both").

Allowed values:leftrightboth

sum_trafficinteger or null

(10 units) An estimation of the monthly organic search traffic that a page gets from all the keywords that it ranks for.

sum_traffic_mergedinteger

(10 units) The traffic field optimized for sorting.

sum_traffic_previnteger or null

(10 units) The traffic on the comparison date.

top_keywordstring or null

The keyword that brings the most organic traffic to a page.

top_keyword_best_positioninteger or null

The ranking position that a page holds for its top keyword.

top_keyword_best_position_diffinteger or null

The change in the top position between your selected dates.

top_keyword_best_position_kindstring or null

The kind of the top position: organic, paid or a SERP feature.

Allowed values:paid_toppaid_bottompaid_rightpaid_sitelinkorganicsitelinksnippetimagearticleknowledge_cardknowledge_panellocal_packlocal_teasernewsquestionreviewshoppingtweetspellingvideodiscussionai_overviewai_overview_sitelinkorganic_shopping

top_keyword_best_position_kind_prevstring or null

The kind of the top position on the comparison date.

top_keyword_best_position_previnteger or null

The top position on the comparison date.

top_keyword_best_position_titlestring or null

The title displayed for the page in its top keyword's SERP.

top_keyword_best_position_title_prevstring or null

The title displayed for the page in its top keyword's SERP on the comparison date.

top_keyword_countrystring or null

The country in which a page ranks for its top keyword.

Allowed values:ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMOTHERPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZW

top_keyword_country_prevstring or null

The country in which a page ranks for its top keyword on the comparison date.

top_keyword_prevstring or null

The keyword that brings the most organic traffic to a page on the comparison date.

top_keyword_volumeinteger or null

(10 units) An estimation of the average monthly number of searches for the top keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.

top_keyword_volume_previnteger or null

(10 units) The search volume on the comparison date.

traffic_diffinteger

The change in traffic between your selected dates.

traffic_diff_percentinteger

The change in traffic between your selected dates, in percents.

urnumber (float) or null

URL Rating (UR) shows the strength of your target page’s backlink profile on a 100-point logarithmic scale.

urlstring (url) or null

The ranking page URL.

url_prevstring (url) or null

The ranking page URL on the comparison date.

valueinteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents.

value_diffinteger

The change in traffic value between your selected dates.

value_diff_percentinteger

The change in traffic value between your selected dates, in percents.

value_mergedinteger or null

(10 units) The traffic value field optimized for sorting.

value_previnteger or null

(10 units) The traffic value on the comparison date.