Docs
Search docs...⌘K

Organic competitors

API + MCP
GET/v3/site-explorer/organic-competitors

Query parameters

timeoutinteger

A manual timeout duration in seconds.

limitinteger

The number of results to return.

Default:1000
order_bystring

A comma-separated list of columns to order results by, with optional direction. See response schema for valid column identifiers.

Example:field_a,field_b:asc,field_c:desc
wherestring

The filter expression. The following column identifiers are recognized (this differs from the identifiers recognized by the select parameter).

competitor_domain: A competitor's domain of your target in “domains" group mode.
type: domain nullable

competitor_url: A competitor's URL of your target in pages" group mode.
type: url nullable

cpc_competitor: Cost Per Click shows the average price that advertisers pay for each ad click in paid search results for a keyword, in USD cents for a competitor.
type: integer nullable

cpc_target: Cost Per Click shows the average price that advertisers pay for each ad click in paid search results for a keyword, in USD cents for a target.
type: integer nullable

domain_rating: The strength of a domain's backlink profile compared to the others in our database on a 100-point scale.
type: float

group_mode: To see competing pages instead, use the “exact URL” target mode or “path” target mode if your target doesn't have multiple pages.
type: string
enum: "domains" "pages"

keyword_difficulty_competitor (10 units): An estimation of how hard it is to rank in the top 10 organic search results for a keyword on a 100-point scale for a competitor.
type: integer nullable

keyword_difficulty_target (10 units): An estimation of how hard it is to rank in the top 10 organic search results for a keyword on a 100-point scale for a target.
type: integer nullable

keywords_common: Organic keywords that both your target and a competitor are ranking for.
type: integer

keywords_competitor: Organic keywords that a competitor is ranking for, but your target isn't.
type: integer

keywords_target: Organic keywords that your target is ranking for, but a competitor isn't.
type: integer

pages: The total number of pages from a target ranking in search results.
type: integer nullable

pages_diff: The change in pages between your selected dates.
type: integer

pages_merged: The pages field optimized for sorting.
type: integer

pages_prev: The total number of pages from a target ranking in search results on the comparison date.
type: integer nullable

share: The percentage of common keywords out of the total number of keywords that your target and a competitor both rank for.
type: float

traffic (10 units): An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.
type: integer nullable

traffic_diff: The change in traffic between your selected dates.
type: integer

traffic_merged (10 units): The traffic field optimized for sorting.
type: integer

traffic_prev (10 units): An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter on the comparison date.
type: integer nullable

value (10 units): The estimated value of a page's monthly organic search traffic, in USD cents.
type: integer nullable

value_diff: The change in value between your selected dates.
type: integer

value_merged (10 units): The value field optimized for sorting.
type: integer nullable

value_prev (10 units): The estimated value of a page's monthly organic search traffic, in USD cents on the comparison date.
type: integer nullable

volume_competitor (10 units): An estimation of the average monthly number of searches for a keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter for a competitor.
type: integer nullable

volume_target (10 units): An estimation of the average monthly number of searches for a keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter for a target.
type: integer nullable

words_competitor: The number of words in a keyword for a competitor.
type: integer

words_target: The number of words in a keyword for a target.
type: integer

selectstringRequired

A comma-separated list of columns to return. See response schema for valid column identifiers.

protocolstring

The protocol of your target.

Allowed values:bothhttphttps
Default:both
targetstringRequired

The target of the search: a domain or a URL.

modestring

The scope of the search based on the target you entered.

Allowed values:exactprefixdomainsubdomains
Default:subdomains
countrystringRequired

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw
date_comparedstring (date)

A date to compare metrics with in YYYY-MM-DD format.

datestring (date)Required

A date to report metrics on in YYYY-MM-DD format.

volume_modestring

The search volume calculation mode: monthly or average. It affects volume, traffic, and traffic value.

Allowed values:monthlyaverage
Default:monthly
outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

competitorsarray<object>
competitor_domainstring (domain) or null

A competitor's domain of your target in “domains" group mode.

competitor_urlstring (url) or null

A competitor's URL of your target in pages" group mode.

domain_ratingnumber (float)

The strength of a domain's backlink profile compared to the others in our database on a 100-point scale.

group_modestring

To see competing pages instead, use the “exact URL” target mode or “path” target mode if your target doesn't have multiple pages.

Allowed values:domainspages
keywords_commoninteger

Organic keywords that both your target and a competitor are ranking for.

keywords_competitorinteger

Organic keywords that a competitor is ranking for, but your target isn't.

keywords_targetinteger

Organic keywords that your target is ranking for, but a competitor isn't.

pagesinteger or null

The total number of pages from a target ranking in search results.

pages_diffinteger

The change in pages between your selected dates.

pages_mergedinteger

The pages field optimized for sorting.

pages_previnteger or null

The total number of pages from a target ranking in search results on the comparison date.

sharenumber (float)

The percentage of common keywords out of the total number of keywords that your target and a competitor both rank for.

trafficinteger or null

(10 units) An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.

traffic_diffinteger

The change in traffic between your selected dates.

traffic_mergedinteger

(10 units) The traffic field optimized for sorting.

traffic_previnteger or null

(10 units) An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter on the comparison date.

valueinteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents.

value_diffinteger

The change in value between your selected dates.

value_mergedinteger or null

(10 units) The value field optimized for sorting.

value_previnteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents on the comparison date.