Docs
Search docs...⌘K

Top pages

GET/v3/site-explorer/top-pages

Query parameters

timeoutinteger

A manual timeout duration in seconds.

limitinteger

The number of results to return.

Default:1000
order_bystring

A column to order results by. See response schema for valid column identifiers.

wherestring

The filter expression. The following column identifiers are recognized (this differs from the identifiers recognized by the select parameter).

cpc
type: integer nullable

cpc_prev: The CPC metric on the comparison date.
type: integer nullable

has_thumbnail: The position has a thumbnail.
type: boolean

has_thumbnail_prev: The position has a thumbnail on the comparison date.
type: boolean

has_video: The position has a video.
type: boolean

has_video_prev: The position has a video on the comparison date.
type: boolean

keyword: The keyword your target ranks for.
type: string

keyword_difficulty (10 units): An estimation of how hard it is to rank in the top 10 organic search results for a keyword on a 100-point scale.
type: integer nullable

keyword_difficulty_prev (10 units): The keyword difficulty on the comparison date.
type: integer nullable

keyword_prev: The keyword your target ranks for on the comparison date.
type: string

keywords: The total number of keywords that your target ranks for in the top 100 organic search results.
type: integer

keywords_diff: The change in keywords between your selected dates.
type: integer

keywords_diff_percent: The change in keywords between your selected dates, in percents.
type: integer

keywords_merged: The total number of keywords optimized for sorting.
type: integer

keywords_prev: The keyword your target ranks for on the comparison date.
type: integer

page_type: Comma-separated list of AI-predicted hierarchical page type paths. Each value is a slash-prefixed path (e.g. /Article/How_to).
type: string nullable

position: The position your target ranks for in the organic search results for a keyword.
type: integer

position_kind: The kind of a position: organic, paid or a SERP feature. This applies to all positions for a given keyword and URL before picking the top position.
type: string
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping"

position_kind_prev: The kind of a position on the comparison date.
type: string
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping"

position_prev: The position of your target for a given keyword on the comparison date.
type: integer

raw_url: The ranking page URL in encoded format.
type: string

raw_url_prev: The ranking page URL on the comparison date in encoded format.
type: string

referring_domains (5 units): The number of unique domains linking to a page.
type: integer nullable

serp_features
type: array(string)
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping" "image_th" "video_th" "ai_overview_found"

serp_features_prev: The SERP features on the comparison date.
type: array(string)
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping" "image_th" "video_th" "ai_overview_found"

status: The status of a page: the new page that just started to rank ("left"), the lost page that disappeared from search results ("right"), or no change ("both").
type: string
enum: "left" "right" "both"

sum_traffic (10 units): An estimation of the monthly organic search traffic that a page gets from all the keywords that it ranks for.
type: integer nullable

sum_traffic_merged (10 units): The traffic field optimized for sorting.
type: integer

sum_traffic_prev (10 units): The traffic on the comparison date.
type: integer nullable

top_keyword: The keyword that brings the most organic traffic to a page.
type: string nullable

top_keyword_best_position: The ranking position that a page holds for its top keyword.
type: integer nullable

top_keyword_best_position_diff: The change in the top position between your selected dates.
type: integer nullable

top_keyword_best_position_kind: The kind of the top position: organic, paid or a SERP feature.
type: string nullable
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping"

top_keyword_best_position_kind_prev: The kind of the top position on the comparison date.
type: string nullable
enum: "paid_top" "paid_bottom" "paid_right" "paid_sitelink" "organic" "sitelink" "snippet" "image" "article" "knowledge_card" "knowledge_panel" "local_pack" "local_teaser" "news" "question" "review" "shopping" "tweet" "spelling" "video" "discussion" "ai_overview" "ai_overview_sitelink" "organic_shopping"

top_keyword_best_position_prev: The top position on the comparison date.
type: integer nullable

top_keyword_best_position_title: The title displayed for the page in its top keyword's SERP.
type: string nullable

top_keyword_best_position_title_prev: The title displayed for the page in its top keyword's SERP on the comparison date.
type: string nullable

top_keyword_country: The country in which a page ranks for its top keyword.
type: string nullable
enum: "AD" "AE" "AF" "AG" "AI" "AL" "AM" "AO" "AQ" "AR" "AS" "AT" "AU" "AW" "AX" "AZ" "BA" "BB" "BD" "BE" "BF" "BG" "BH" "BI" "BJ" "BL" "BM" "BN" "BO" "BQ" "BR" "BS" "BT" "BV" "BW" "BY" "BZ" "CA" "CC" "CD" "CF" "CG" "CH" "CI" "CK" "CL" "CM" "CN" "CO" "CR" "CU" "CV" "CW" "CX" "CY" "CZ" "DE" "DJ" "DK" "DM" "DO" "DZ" "EC" "EE" "EG" "EH" "ER" "ES" "ET" "FI" "FJ" "FK" "FM" "FO" "FR" "GA" "GB" "GD" "GE" "GF" "GG" "GH" "GI" "GL" "GM" "GN" "GP" "GQ" "GR" "GS" "GT" "GU" "GW" "GY" "HK" "HM" "HN" "HR" "HT" "HU" "ID" "IE" "IL" "IM" "IN" "IO" "IQ" "IR" "IS" "IT" "JE" "JM" "JO" "JP" "KE" "KG" "KH" "KI" "KM" "KN" "KP" "KR" "KW" "KY" "KZ" "LA" "LB" "LC" "LI" "LK" "LR" "LS" "LT" "LU" "LV" "LY" "MA" "MC" "MD" "ME" "MF" "MG" "MH" "MK" "ML" "MM" "MN" "MO" "MP" "MQ" "MR" "MS" "MT" "MU" "MV" "MW" "MX" "MY" "MZ" "NA" "NC" "NE" "NF" "NG" "NI" "NL" "NO" "NP" "NR" "NU" "NZ" "OM" "OTHER" "PA" "PE" "PF" "PG" "PH" "PK" "PL" "PM" "PN" "PR" "PS" "PT" "PW" "PY" "QA" "RE" "RO" "RS" "RU" "RW" "SA" "SB" "SC" "SD" "SE" "SG" "SH" "SI" "SJ" "SK" "SL" "SM" "SN" "SO" "SR" "SS" "ST" "SV" "SX" "SY" "SZ" "TC" "TD" "TF" "TG" "TH" "TJ" "TK" "TL" "TM" "TN" "TO" "TR" "TT" "TV" "TW" "TZ" "UA" "UG" "UM" "US" "UY" "UZ" "VA" "VC" "VE" "VG" "VI" "VN" "VU" "WF" "WS" "YE" "YT" "ZA" "ZM" "ZW"

top_keyword_country_prev: The country in which a page ranks for its top keyword on the comparison date.
type: string nullable
enum: "AD" "AE" "AF" "AG" "AI" "AL" "AM" "AO" "AQ" "AR" "AS" "AT" "AU" "AW" "AX" "AZ" "BA" "BB" "BD" "BE" "BF" "BG" "BH" "BI" "BJ" "BL" "BM" "BN" "BO" "BQ" "BR" "BS" "BT" "BV" "BW" "BY" "BZ" "CA" "CC" "CD" "CF" "CG" "CH" "CI" "CK" "CL" "CM" "CN" "CO" "CR" "CU" "CV" "CW" "CX" "CY" "CZ" "DE" "DJ" "DK" "DM" "DO" "DZ" "EC" "EE" "EG" "EH" "ER" "ES" "ET" "FI" "FJ" "FK" "FM" "FO" "FR" "GA" "GB" "GD" "GE" "GF" "GG" "GH" "GI" "GL" "GM" "GN" "GP" "GQ" "GR" "GS" "GT" "GU" "GW" "GY" "HK" "HM" "HN" "HR" "HT" "HU" "ID" "IE" "IL" "IM" "IN" "IO" "IQ" "IR" "IS" "IT" "JE" "JM" "JO" "JP" "KE" "KG" "KH" "KI" "KM" "KN" "KP" "KR" "KW" "KY" "KZ" "LA" "LB" "LC" "LI" "LK" "LR" "LS" "LT" "LU" "LV" "LY" "MA" "MC" "MD" "ME" "MF" "MG" "MH" "MK" "ML" "MM" "MN" "MO" "MP" "MQ" "MR" "MS" "MT" "MU" "MV" "MW" "MX" "MY" "MZ" "NA" "NC" "NE" "NF" "NG" "NI" "NL" "NO" "NP" "NR" "NU" "NZ" "OM" "OTHER" "PA" "PE" "PF" "PG" "PH" "PK" "PL" "PM" "PN" "PR" "PS" "PT" "PW" "PY" "QA" "RE" "RO" "RS" "RU" "RW" "SA" "SB" "SC" "SD" "SE" "SG" "SH" "SI" "SJ" "SK" "SL" "SM" "SN" "SO" "SR" "SS" "ST" "SV" "SX" "SY" "SZ" "TC" "TD" "TF" "TG" "TH" "TJ" "TK" "TL" "TM" "TN" "TO" "TR" "TT" "TV" "TW" "TZ" "UA" "UG" "UM" "US" "UY" "UZ" "VA" "VC" "VE" "VG" "VI" "VN" "VU" "WF" "WS" "YE" "YT" "ZA" "ZM" "ZW"

top_keyword_prev: The keyword that brings the most organic traffic to a page on the comparison date.
type: string nullable

top_keyword_volume (10 units): An estimation of the average monthly number of searches for the top keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.
type: integer nullable

top_keyword_volume_prev (10 units): The search volume on the comparison date.
type: integer nullable

traffic (10 units): An estimation of the number of monthly visitors that your target gets from organic search for a keyword.
type: integer

traffic_diff: The change in traffic between your selected dates.
type: integer

traffic_diff_percent: The change in traffic between your selected dates, in percents.
type: integer

traffic_prev (10 units): The traffic from a keyword on the comparison date.
type: integer

ur: URL Rating (UR) shows the strength of your target page’s backlink profile on a 100-point logarithmic scale.
type: float nullable

url: The ranking page URL.
type: url nullable

url_prev: The ranking page URL on the comparison date.
type: url nullable

value (10 units): The estimated value of a page's monthly organic search traffic, in USD cents.
type: integer nullable

value_diff: The change in traffic value between your selected dates.
type: integer

value_diff_percent: The change in traffic value between your selected dates, in percents.
type: integer

value_merged (10 units): The traffic value field optimized for sorting.
type: integer nullable

value_prev (10 units): The traffic value on the comparison date.
type: integer nullable

volume (10 units): An estimation of the number of searches for a keyword over the latest month.
type: integer nullable

volume_prev (10 units): The search volume on the comparison date.
type: integer nullable

words: The number of words in a keyword.
type: integer

words_prev: The number of words in a keyword on the comparison date.
type: integer

selectstringRequired

A comma-separated list of columns to return. See response schema for valid column identifiers.

protocolstring

The protocol of your target.

Allowed values:bothhttphttps
Default:both
targetstringRequired

The target of the search: a domain or a URL.

modestring

The scope of the search based on the target you entered.

Allowed values:exactprefixdomainsubdomains
Default:subdomains
countrystring

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw
date_comparedstring

A date to compare metrics with in YYYY-MM-DD format.

datestringRequired

A date to report metrics on in YYYY-MM-DD format.

volume_modestring

The search volume calculation mode: monthly or average. It affects volume, traffic, and traffic value.

Allowed values:monthlyaverage
Default:monthly
outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

pagesarray
keywordsinteger or null

The total number of keywords that your target ranks for in the top 100 organic search results.

keywords_diffinteger

The change in keywords between your selected dates.

keywords_diff_percentinteger

The change in keywords between your selected dates, in percents.

keywords_mergedinteger

The total number of keywords optimized for sorting.

keywords_previnteger or null

The keyword your target ranks for on the comparison date.

page_typestring or null

Comma-separated list of AI-predicted hierarchical page type paths. Each value is a slash-prefixed path (e.g. /Article/How_to).

raw_urlstring

The ranking page URL in encoded format.

raw_url_prevstring or null

The ranking page URL on the comparison date in encoded format.

referring_domainsinteger or null

(5 units) The number of unique domains linking to a page.

statusstring

The status of a page: the new page that just started to rank ("left"), the lost page that disappeared from search results ("right"), or no change ("both").

leftrightboth
sum_trafficinteger or null

(10 units) An estimation of the monthly organic search traffic that a page gets from all the keywords that it ranks for.

sum_traffic_mergedinteger

(10 units) The traffic field optimized for sorting.

sum_traffic_previnteger or null

(10 units) The traffic on the comparison date.

top_keywordstring or null

The keyword that brings the most organic traffic to a page.

top_keyword_best_positioninteger or null

The ranking position that a page holds for its top keyword.

top_keyword_best_position_diffinteger or null

The change in the top position between your selected dates.

top_keyword_best_position_kindstring or null

The kind of the top position: organic, paid or a SERP feature.

paid_toppaid_bottompaid_rightpaid_sitelinkorganicsitelinksnippetimagearticleknowledge_cardknowledge_panellocal_packlocal_teasernewsquestionreviewshoppingtweetspellingvideodiscussionai_overviewai_overview_sitelinkorganic_shopping
top_keyword_best_position_kind_prevstring or null

The kind of the top position on the comparison date.

paid_toppaid_bottompaid_rightpaid_sitelinkorganicsitelinksnippetimagearticleknowledge_cardknowledge_panellocal_packlocal_teasernewsquestionreviewshoppingtweetspellingvideodiscussionai_overviewai_overview_sitelinkorganic_shopping
top_keyword_best_position_previnteger or null

The top position on the comparison date.

top_keyword_best_position_titlestring or null

The title displayed for the page in its top keyword's SERP.

top_keyword_best_position_title_prevstring or null

The title displayed for the page in its top keyword's SERP on the comparison date.

top_keyword_countrystring or null

The country in which a page ranks for its top keyword.

ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMOTHERPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZW
top_keyword_country_prevstring or null

The country in which a page ranks for its top keyword on the comparison date.

ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQIRISITJEJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMOTHERPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSSSTSVSXSYSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTZAZMZW
top_keyword_prevstring or null

The keyword that brings the most organic traffic to a page on the comparison date.

top_keyword_volumeinteger or null

(10 units) An estimation of the average monthly number of searches for the top keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.

top_keyword_volume_previnteger or null

(10 units) The search volume on the comparison date.

traffic_diffinteger

The change in traffic between your selected dates.

traffic_diff_percentinteger

The change in traffic between your selected dates, in percents.

urnumber or null

URL Rating (UR) shows the strength of your target page’s backlink profile on a 100-point logarithmic scale.

urlstring or null

The ranking page URL.

url_prevstring or null

The ranking page URL on the comparison date.

valueinteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents.

value_diffinteger

The change in traffic value between your selected dates.

value_diff_percentinteger

The change in traffic value between your selected dates, in percents.

value_mergedinteger or null

(10 units) The traffic value field optimized for sorting.

value_previnteger or null

(10 units) The traffic value on the comparison date.