Organic competitors

GET/v3/site-explorer/organic-competitors

Query parameters

timeoutinteger

A manual timeout duration in seconds.

limitinteger

The number of results to return.

Default:1000

order_bystring

A column to order results by. See response schema for valid column identifiers.

wherestring

The filter expression. The following column identifiers are recognized (this differs from the identifiers recognized by the select parameter).

competitor_domain: A competitor's domain of your target in “domains" group mode.
type: domain nullable

competitor_url: A competitor's URL of your target in pages" group mode.
type: url nullable

cpc_competitor: Cost Per Click shows the average price that advertisers pay for each ad click in paid search results for a keyword, in USD cents for a competitor.
type: integer nullable

cpc_target: Cost Per Click shows the average price that advertisers pay for each ad click in paid search results for a keyword, in USD cents for a target.
type: integer nullable

domain_rating: The strength of a domain's backlink profile compared to the others in our database on a 100-point scale.
type: float

group_mode: To see competing pages instead, use the “exact URL” target mode or “path” target mode if your target doesn't have multiple pages.
type: string
enum: "domains" "pages"

keyword_difficulty_competitor (10 units): An estimation of how hard it is to rank in the top 10 organic search results for a keyword on a 100-point scale for a competitor.
type: integer nullable

keyword_difficulty_target (10 units): An estimation of how hard it is to rank in the top 10 organic search results for a keyword on a 100-point scale for a target.
type: integer nullable

keywords_common: Organic keywords that both your target and a competitor are ranking for.
type: integer

keywords_competitor: Organic keywords that a competitor is ranking for, but your target isn't.
type: integer

keywords_target: Organic keywords that your target is ranking for, but a competitor isn't.
type: integer

pages: The total number of pages from a target ranking in search results.
type: integer nullable

pages_diff: The change in pages between your selected dates.
type: integer

pages_merged: The pages field optimized for sorting.
type: integer

pages_prev: The total number of pages from a target ranking in search results on the comparison date.
type: integer nullable

share: The percentage of common keywords out of the total number of keywords that your target and a competitor both rank for.
type: float

traffic (10 units): An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.
type: integer nullable

traffic_diff: The change in traffic between your selected dates.
type: integer

traffic_merged (10 units): The traffic field optimized for sorting.
type: integer

traffic_prev (10 units): An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter on the comparison date.
type: integer nullable

value (10 units): The estimated value of a page's monthly organic search traffic, in USD cents.
type: integer nullable

value_diff: The change in value between your selected dates.
type: integer

value_merged (10 units): The value field optimized for sorting.
type: integer nullable

value_prev (10 units): The estimated value of a page's monthly organic search traffic, in USD cents on the comparison date.
type: integer nullable

volume_competitor (10 units): An estimation of the average monthly number of searches for a keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter for a competitor.
type: integer nullable

volume_target (10 units): An estimation of the average monthly number of searches for a keyword over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter for a target.
type: integer nullable

words_competitor: The number of words in a keyword for a competitor.
type: integer

words_target: The number of words in a keyword for a target.
type: integer

selectstringRequired

A comma-separated list of columns to return. See response schema for valid column identifiers.

protocolstring

The protocol of your target.

Allowed values:bothhttphttps

Default:both

targetstringRequired

The target of the search: a domain or a URL.

modestring

The scope of the search based on the target you entered.

Allowed values:exactprefixdomainsubdomains

Default:subdomains

countrystringRequired

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw

date_comparedstring

A date to compare metrics with in YYYY-MM-DD format.

datestringRequired

A date to report metrics on in YYYY-MM-DD format.

volume_modestring

The search volume calculation mode: monthly or average. It affects volume, traffic, and traffic value.

Allowed values:monthlyaverage

Default:monthly

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

competitorsarray

competitor_domainstring or null

A competitor's domain of your target in “domains" group mode.

competitor_urlstring or null

A competitor's URL of your target in pages" group mode.

domain_ratingnumber

The strength of a domain's backlink profile compared to the others in our database on a 100-point scale.

group_modestring

To see competing pages instead, use the “exact URL” target mode or “path” target mode if your target doesn't have multiple pages.

domainspages

keywords_commoninteger

Organic keywords that both your target and a competitor are ranking for.

keywords_competitorinteger

Organic keywords that a competitor is ranking for, but your target isn't.

keywords_targetinteger

Organic keywords that your target is ranking for, but a competitor isn't.

pagesinteger or null

The total number of pages from a target ranking in search results.

pages_diffinteger

The change in pages between your selected dates.

pages_mergedinteger

The pages field optimized for sorting.

pages_previnteger or null

The total number of pages from a target ranking in search results on the comparison date.

sharenumber

The percentage of common keywords out of the total number of keywords that your target and a competitor both rank for.

trafficinteger or null

(10 units) An estimation of the number of monthly visits that a page gets from organic search over the latest month or over the latest known 12 months of data depending on the "volume_mode" parameter.

traffic_diffinteger

The change in traffic between your selected dates.

traffic_mergedinteger

(10 units) The traffic field optimized for sorting.

traffic_previnteger or null

valueinteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents.

value_diffinteger

The change in value between your selected dates.

value_mergedinteger or null

(10 units) The value field optimized for sorting.

value_previnteger or null

(10 units) The estimated value of a page's monthly organic search traffic, in USD cents on the comparison date.