Docs
Search docs...⌘K

SERP Overview

API + MCP
GET/v3/rank-tracker/serp-overview

Requests to this endpoint are free and do not consume any API units.

Query parameters

top_positionsinteger

The number of top organic SERP positions to return. If not specified, all available positions will be returned.

devicestringRequired

Choose between mobile and desktop rankings.

Allowed values:desktopmobile
datestring (date-time)

A timestamp on which the last available SERP Overview is returned in YYYY-MM-DDThh:mm:ss format. If it is not specified, the most recent SERP Overview is returned.

location_idinteger

The location ID of a tracked keyword.You can use the management/project-keywords endpoint to get country codes, language codes and location IDs for your tracked keywords.

countrystringRequired

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw
language_codestring

The language code of a tracked keyword.You can use the management/project-keywords endpoint to get country codes, language codes and location IDs for your tracked keywords.

keywordstringRequired

The keyword to return SERP Overview for.

project_idintegerRequired

The unique identifier of the project. You can find it in the URL of your Rank Tracker project in Ahrefs: https://app.ahrefs.com/rank-tracker/overview/#project_id#

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

positionsarray<object>
ahrefs_rankinteger or null

The strength of a domain's backlink profile compared to the other websites in our database, with rank #1 being the strongest.

backlinksinteger or null

The total number of links from other websites pointing to a search result.

domain_ratingnumber (float) or null

The strength of a domain’s backlink profile compared to the others in our database on a 100-point scale.

keywordsinteger or null

The total number of keywords that a search result ranks for in the top 100 organic positions.

nr_wordsinteger or null

The total number of words present in the HTML of a web page.

page_typestring or null

Comma-separated list of AI-predicted hierarchical page type paths for the ranking page. Each value is a slash-prefixed path (e.g. /Article/How_to).

positioninteger

The position of the search result in SERP.

refdomainsinteger or null

The total number of unique domains linking to a search result.

titlestring or null

The title of a ranking page.

top_keywordstring or null

The keyword that brings the most organic traffic to a search result.

top_keyword_volumeinteger or null

An estimation of the average monthly number of searches for the top keyword over the latest known 12 months of data.

trafficinteger or null

An estimation of the monthly organic search traffic that a result gets from all the keywords that it ranks for.

typearray<string>

The kind of the position: organic, paid, or a SERP feature. Allowed values: ai_overview, ai_overview_sitelink, discussion, image, image_th, knowledge_card, knowledge_panel, local_pack, organic, organic_shopping, paid_top, paid_bottom, paid_right, question, sitelink, snippet, top_story, tweet, video, video_th.

update_datestring (date)

The date when we checked search engine results for a keyword.

urlstring (url) or null

The URL of a ranking page.

url_ratingnumber (float) or null

The strength of a page's backlink profile on a 100-point logarithmic scale.

valueinteger or null

The estimated value of a page’s monthly organic search traffic, in USD cents.