SERP Overview

GET/v3/serp-overview/serp-overview

Query parameters

selectstringRequired

A comma-separated list of columns to return. See response schema for valid column identifiers.

top_positionsinteger

The number of top organic SERP positions to return. If not specified, all available positions will be returned.

datestring

A timestamp on which the last available SERP Overview is returned in YYYY-MM-DDThh:mm:ss format. If it is not specified, the most recent SERP Overview is returned.

countrystringRequired

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw

keywordstringRequired

The keyword to return SERP Overview for.

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

positionsarray

ahrefs_rankinteger or null

The strength of a domain's backlink profile compared to the other websites in our database, with rank #1 being the strongest.

backlinksinteger or null

The total number of links from other websites pointing to a search result.

domain_ratingnumber or null

The strength of a domain’s backlink profile compared to the others in our database on a 100-point scale.

keywordsinteger or null

The total number of keywords that a search result ranks for in the top 100 organic positions.

page_typestring or null

Comma-separated list of AI-predicted hierarchical page type paths for the ranking page. Each value is a slash-prefixed path (e.g. /Article/How_to).

positioninteger

The position of the search result in SERP.

refdomainsinteger or null

(5 units) The total number of unique domains linking to a search result.

titlestring or null

The title of a ranking page.

top_keywordstring or null

The keyword that brings the most organic traffic to a search result.

top_keyword_volumeinteger or null

(10 units) An estimation of the average monthly number of searches for the top keyword over the latest known 12 months of data.

trafficinteger or null

(10 units) An estimation of the monthly organic search traffic that a result gets from all the keywords that it ranks for.

typearray

The kind of the position: organic, paid, or a SERP feature.

update_datestring

The date when we checked search engine results for a keyword.

urlstring or null

The URL of a ranking page.

url_ratingnumber or null

The strength of a page's backlink profile on a 100-point logarithmic scale.

valueinteger or null

(10 units) The estimated value of a page’s monthly organic search traffic, in USD cents.