SERP Overview

GET/v3/rank-tracker/serp-overview

Requests to this endpoint are free and do not consume any API units.

Query parameters

top_positionsinteger

The number of top organic SERP positions to return. If not specified, all available positions will be returned.

devicestringRequired

Choose between mobile and desktop rankings.

Allowed values:desktopmobile

datestring

A timestamp on which the last available SERP Overview is returned in YYYY-MM-DDThh:mm:ss format. If it is not specified, the most recent SERP Overview is returned.

location_idinteger

The location ID of a tracked keyword.You can use the management/project-keywords endpoint to get country codes, language codes and location IDs for your tracked keywords.

countrystringRequired

A two-letter country code (ISO 3166-1 alpha-2).

Allowed values:adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw

language_codestring

The language code of a tracked keyword.You can use the management/project-keywords endpoint to get country codes, language codes and location IDs for your tracked keywords.

keywordstringRequired

The keyword to return SERP Overview for.

project_idintegerRequired

The unique identifier of the project. You can find it in the URL of your Rank Tracker project in Ahrefs: https://app.ahrefs.com/rank-tracker/overview/#project_id#

outputstring

The output format.

Allowed values:jsoncsvxmlphp

Responses

positionsarray

positioninteger

The position of the search result in SERP.

titlestring or null

The title of a ranking page.

urlstring or null

The URL of a ranking page.

typearray

The kind of the position: organic, paid, or a SERP feature. Allowed values: ai_overview, ai_overview_sitelink, discussion, image, image_th, knowledge_card, knowledge_panel, local_pack, organic, organic_shopping, paid_top, paid_bottom, paid_right, question, sitelink, snippet, top_story, tweet, video, video_th.

update_datestring

The date when we checked search engine results for a keyword.

nr_wordsinteger or null

The total number of words present in the HTML of a web page.

domain_ratingnumber or null

The strength of a domain’s backlink profile compared to the others in our database on a 100-point scale.

url_ratingnumber or null

The strength of a page's backlink profile on a 100-point logarithmic scale.

ahrefs_rankinteger or null

The strength of a domain's backlink profile compared to the other websites in our database, with rank #1 being the strongest.

backlinksinteger or null

The total number of links from other websites pointing to a search result.

refdomainsinteger or null

The total number of unique domains linking to a search result.

trafficinteger or null

An estimation of the monthly organic search traffic that a result gets from all the keywords that it ranks for.

valueinteger or null

The estimated value of a page’s monthly organic search traffic, in USD cents.

keywordsinteger or null

The total number of keywords that a search result ranks for in the top 100 organic positions.

top_keywordstring or null

The keyword that brings the most organic traffic to a search result.

top_keyword_volumeinteger or null

An estimation of the average monthly number of searches for the top keyword over the latest known 12 months of data.

page_typestring or null

Comma-separated list of AI-predicted hierarchical page type paths for the ranking page. Each value is a slash-prefixed path (e.g. /Article/How_to).