Docs
Search docs...⌘K

Batch Analysis

POST/v3/batch-analysis/batch-analysis

Request body

selectarray

A list of columns to return. See response schema for valid column identifiers.

order_bystring
countrystring

A two-letter country code (ISO 3166-1 alpha-2).

adaeafagaialamaoarasatauawazbabbbdbebfbgbhbibjbnbobrbsbtbwbybzcacdcfcgchcickclcmcncocrcucvcyczdedjdkdmdodzeceeegesetfifjfmfofrgagbgdgegfggghgiglgmgngpgqgrgtgugyhkhnhrhthuidieiliminiqisitjejmjojpkekgkhkiknkrkwkykzlalblclilklsltlulvlymamcmdmemgmkmlmmmnmqmrmsmtmumvmwmxmymznancnengninlnonpnrnunzompapepfpgphpkplpnprpsptpyqarerorsrurwsasbscsesgshsiskslsmsnsosrstsvtdtgthtjtktltmtntotrtttwtzuaugusuyuzvcvevgvivnvuwsyeytzazmzw
volume_modestring

The search volume calculation mode: monthly or average. It affects volume, traffic, and traffic value.

monthlyaverage
targetsarray

A list of targets to do batch analysis.

urlstring

The URL of the analyzed target.

modestring

The target mode used for the analysis.

exactprefixdomainsubdomains
protocolstring

The protocol of the target.

bothhttphttps
outputstring

The output format.

jsonphp

Responses

targetsarray
ahrefs_rankinteger or null

The strength of your target's backlink profile compared to the other websites in our database, with rank #1 being the strongest.

backlinksinteger or null

The total number of links from other websites pointing to your target.

backlinks_dofollowinteger or null

Links to your target that do not contain a “nofollow”, “ugc”, or “sponsored” value in their “rel” attribute. These links are also called “dofollow”.

backlinks_internalinteger or null

The total number of internal links pointing to the target's pages.

backlinks_nofollowinteger or null

Links to your target that contain a “nofollow”, “ugc”, or “sponsored” value in their “rel” attribute.

backlinks_redirectinteger or null

Links pointing to your target via a redirect.

domain_ratingnumber or null

The strength of your target's backlink profile compared to the other websites in our database on a 100-point logarithmic scale.

indexinteger

Target index number.

ipstring or null

The IP address of the target.

linked_domainsinteger or null

The number of unique domains linked from your target.

linked_domains_dofollowinteger or null

The number of unique domains linked from your target with followed links.

modestring

The target mode used for the analysis. Depending on the selected mode (Exact URL, Path, Domain, Subdomains), different parts of the website will be analyzed.

org_costinteger or null

(10 units) The estimated value of your target’s monthly organic search traffic.

org_keywordsinteger or null

The total number of keywords that your target ranks for in the top 100 organic search results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_keywords_11_20integer or null

The total number of unique keywords for which your target's top organic ranking position is within the 11th to 20th results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_keywords_1_3integer or null

The total number of unique keywords for which your target's top organic ranking position is within the top 3 results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_keywords_21_50integer or null

The total number of unique keywords for which your target's top organic ranking position is within the 21st to 50th results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_keywords_4_10integer or null

The total number of unique keywords for which your target's top organic ranking position is within the 4th to 10th results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_keywords_51_plusinteger or null

The total number of unique keywords for which your target's top organic ranking position is the 51st result or higher. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

org_trafficinteger or null

(10 units) The estimated number of monthly visits that your target gets from organic search.

org_traffic_top_by_countryarray

(10 units) Top countries by traffic with corresponding traffic values. (Currently only a single element is being returned with the country with the most traffic.)

outgoing_linksinteger or null

The total number of links from your target to other domains.

outgoing_links_dofollowinteger or null

The total number of followed links from your target to other domains.

paid_adsinteger or null

The total number of unique ads of a target website or URL in paid search results.

paid_costinteger or null

(10 units) The estimated cost of your target’s monthly paid search traffic.

paid_keywordsinteger or null

The total number of keywords that your target ranks for in paid search results. When ranking for the same keyword across different locations in “All locations” mode, it's still counted as one keyword.

paid_trafficinteger or null

(10 units) The estimated number of monthly visits that your target gets from paid search.

protocolstring

The protocol of the target. Possible values: both, http, https.

refdomainsinteger or null

(5 units) The total number of unique domains linking to your target.

refdomains_dofollowinteger or null

(5 units) The number of unique domains with links to your target that do not contain a “nofollow”, “ugc”, or “sponsored” value in their “rel” attribute. These links are also called “dofollow”.

refdomains_nofollowinteger or null

(5 units) The number of unique domains that only have links to your target containing a “nofollow”, “ugc”, or “sponsored” value in their “rel” attribute.

refipsinteger or null

The number of unique IP addresses with at least one domain pointing to your target. Several domains can share one IP address.

refips_subnetsinteger or null

The number of c-class IP networks (AAA.BBB.CCC.DDD) with at least one link to your target. Example: 151.80.39.61 is the website IP address where 151.80.39.XXX is the subnet.

urlstring

The URL of the analyzed target.

url_ratingnumber or null

URL Rating (UR) shows the strength of your target page's backlink profile on a 100-point logarithmic scale. If you analyze a domain, the homepage's UR is shown.